Loading...
Statistics

Leasehold Advice Centre - Lease Extension | Right To Manage | RTM | ...
www.therighttomanage.co.uk/
Leasehold Advice Centre, RTM, The Right To Manage, Lease Extension & Valuation, S42 Notice, buying the Freehold, Collective Enfranchisement, LVT
Advertisement

Therighttomanage.co.uk

Therighttomanage.co.uk is hosted in United Kingdom . Therighttomanage.co.uk uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: Apache.

Technologies in use by Therighttomanage.co.uk

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Therighttomanage.co.uk

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HOSTING SERVICES, INC./OU=PositiveSSL/CN=cpanel34.uk2.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HOSTING SERVICES, INC.
        • 2: PositiveSSL
      • CN: cpanel34.uk2.net
    • hash: ff3745f3
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 248239649411717216484659235605018071210
    • validFrom: 160223000000Z
    • validTo: 170222235959Z
    • validFrom_time_t: 1456185600
    • validTo_time_t: 1487807999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 6E:64:08:F3:B0:99:C9:67:2A:8C:0F:5C:D4:8F:33:5B:0D:87:47:89
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:cpanel34.uk2.net, DNS:www.cpanel34.uk2.net

Meta - Therighttomanage.co.uk

Number of occurences: 3
  • Name:
    Content: text/html; charset=windows-1252
  • Name: keywords
    Content: leasehold, leasehold advice centre, rtm, leasehold reform, LEASE, right to manage, lease extension, ground rent, new lease, right to manage leaseholder, collective enfranchisement, leasehold tenant, RTM, freehold purchase, short lease, Leasehold Reform Housing and Urban Development Act, Commonhold and Leasehold Reform Act, landlord, service charges, managing agent, leasehold valuation, leasehold advice, commonhold, flat, flats, leasehold flat, premium, leasehold valuation tribunal, LVT, S42, Section 42 Notice
  • Name: description
    Content: Leasehold Advice Centre, RTM, The Right To Manage, Lease Extension & Valuation, S42 Notice, buying the Freehold, Collective Enfranchisement, LVT

Server / Hosting

  • IP: 109.123.75.100
  • Latitude: 51.50
  • Longitude: -0.13
  • Country: United Kingdom

Rname

  • ultra103.uk2.net
  • ultra104.uk2.net
  • mx.therighttomanage.co.uk.cust.a.hostedemail.com

Target

  • hostmaster.therighttomanage.co.uk

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 31 May 2016 12:25:00 GMT Server: Apache Last-Modified: Thu, 23 Oct 2014 16:15:23 GMT Accept-Ranges: bytes Content-Length: 405356 Content-Type: text/html X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

DNS

host: therighttomanage.co.uk
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 109.123.75.100
host: therighttomanage.co.uk
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ultra103.uk2.net
host: therighttomanage.co.uk
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ultra104.uk2.net
host: therighttomanage.co.uk
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ultra103.uk2.net
  5. rname: hostmaster.therighttomanage.co.uk
  6. serial: 2014100816
  7. refresh: 10800
  8. retry: 1800
  9. expire: 604800
  10. minimum-ttl: 86400
host: therighttomanage.co.uk
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 0
  5. target: mx.therighttomanage.co.uk.cust.a.hostedemail.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.herighttomanage.co.uk, www.tqherighttomanage.co.uk, www.qherighttomanage.co.uk, www.taherighttomanage.co.uk, www.aherighttomanage.co.uk, www.t herighttomanage.co.uk, www. herighttomanage.co.uk, www.twherighttomanage.co.uk, www.wherighttomanage.co.uk, www.teherighttomanage.co.uk, www.eherighttomanage.co.uk, www.tzherighttomanage.co.uk, www.zherighttomanage.co.uk, www.txherighttomanage.co.uk, www.xherighttomanage.co.uk, www.tcherighttomanage.co.uk, www.cherighttomanage.co.uk, www.terighttomanage.co.uk, www.theerighttomanage.co.uk, www.teerighttomanage.co.uk, www.thderighttomanage.co.uk, www.tderighttomanage.co.uk, www.thcerighttomanage.co.uk, www.tcerighttomanage.co.uk, www.thuerighttomanage.co.uk, www.tuerighttomanage.co.uk, www.thjerighttomanage.co.uk, www.tjerighttomanage.co.uk, www.therighttomanage.co.uk, www.terighttomanage.co.uk, www.thberighttomanage.co.uk, www.tberighttomanage.co.uk, www.thgerighttomanage.co.uk, www.tgerighttomanage.co.uk, www.thrighttomanage.co.uk, www.thexrighttomanage.co.uk, www.thxrighttomanage.co.uk, www.thesrighttomanage.co.uk, www.thsrighttomanage.co.uk, www.thewrighttomanage.co.uk, www.thwrighttomanage.co.uk, www.therrighttomanage.co.uk, www.thrrighttomanage.co.uk, www.thefrighttomanage.co.uk, www.thfrighttomanage.co.uk, www.thevrighttomanage.co.uk, www.thvrighttomanage.co.uk, www.thecrighttomanage.co.uk, www.thcrighttomanage.co.uk, www.theqrighttomanage.co.uk, www.thqrighttomanage.co.uk, www.thearighttomanage.co.uk, www.tharighttomanage.co.uk, www.theyrighttomanage.co.uk, www.thyrighttomanage.co.uk, www.theighttomanage.co.uk, www.theriighttomanage.co.uk, www.theiighttomanage.co.uk, www.theroighttomanage.co.uk, www.theoighttomanage.co.uk, www.therlighttomanage.co.uk, www.thelighttomanage.co.uk, www.therlighttomanage.co.uk, www.thelighttomanage.co.uk, www.ther.ighttomanage.co.uk, www.the.ighttomanage.co.uk, www.therghttomanage.co.uk, www.therirghttomanage.co.uk, www.therrghttomanage.co.uk, www.therifghttomanage.co.uk, www.therfghttomanage.co.uk, www.therivghttomanage.co.uk, www.thervghttomanage.co.uk, www.therikghttomanage.co.uk, www.therkghttomanage.co.uk, www.theri,ghttomanage.co.uk, www.ther,ghttomanage.co.uk, www.theribghttomanage.co.uk, www.therbghttomanage.co.uk, www.therigghttomanage.co.uk, www.thergghttomanage.co.uk, www.theritghttomanage.co.uk, www.thertghttomanage.co.uk, www.theriyghttomanage.co.uk, www.theryghttomanage.co.uk, www.theriughttomanage.co.uk, www.therughttomanage.co.uk, www.therijghttomanage.co.uk, www.therjghttomanage.co.uk, www.therimghttomanage.co.uk, www.thermghttomanage.co.uk, www.theringhttomanage.co.uk, www.thernghttomanage.co.uk, www.therihttomanage.co.uk, www.therigshttomanage.co.uk, www.therishttomanage.co.uk, www.therigxhttomanage.co.uk, www.therixhttomanage.co.uk, www.therigyhttomanage.co.uk, www.theriyhttomanage.co.uk, www.therighhttomanage.co.uk, www.therihhttomanage.co.uk, www.therignhttomanage.co.uk, www.therinhttomanage.co.uk, www.therigchttomanage.co.uk, www.therichttomanage.co.uk, www.therigdhttomanage.co.uk, www.theridhttomanage.co.uk, www.therigehttomanage.co.uk, www.theriehttomanage.co.uk, www.therigrhttomanage.co.uk, www.therirhttomanage.co.uk, www.therigthttomanage.co.uk, www.therithttomanage.co.uk, www.therigbhttomanage.co.uk, www.theribhttomanage.co.uk, www.therigvhttomanage.co.uk, www.therivhttomanage.co.uk, www.therigttomanage.co.uk, www.therighettomanage.co.uk, www.therigettomanage.co.uk, www.therighdttomanage.co.uk, www.therigdttomanage.co.uk, www.therighcttomanage.co.uk, www.therigcttomanage.co.uk, www.therighuttomanage.co.uk, www.theriguttomanage.co.uk, www.therighjttomanage.co.uk, www.therigjttomanage.co.uk, www.therighttomanage.co.uk, www.therigttomanage.co.uk, www.therighbttomanage.co.uk, www.therigbttomanage.co.uk, www.therighgttomanage.co.uk, www.theriggttomanage.co.uk, www.therightomanage.co.uk, www.therightqtomanage.co.uk, www.therighqtomanage.co.uk, www.therightatomanage.co.uk, www.therighatomanage.co.uk, www.theright tomanage.co.uk, www.therigh tomanage.co.uk, www.therightwtomanage.co.uk, www.therighwtomanage.co.uk, www.therightetomanage.co.uk, www.therighetomanage.co.uk, www.therightztomanage.co.uk, www.therighztomanage.co.uk, www.therightxtomanage.co.uk, www.therighxtomanage.co.uk, www.therightctomanage.co.uk, www.therighctomanage.co.uk, www.therightomanage.co.uk, www.therighttqomanage.co.uk, www.therightqomanage.co.uk, www.therighttaomanage.co.uk, www.therightaomanage.co.uk, www.therightt omanage.co.uk, www.theright omanage.co.uk, www.therighttwomanage.co.uk, www.therightwomanage.co.uk, www.therightteomanage.co.uk, www.therighteomanage.co.uk, www.therighttzomanage.co.uk, www.therightzomanage.co.uk, www.therighttxomanage.co.uk, www.therightxomanage.co.uk, www.therighttcomanage.co.uk, www.therightcomanage.co.uk,

Other Reviews

  1. PreservingEggs.com
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 3
  2. Rock'n'Road Cycle South Haven
    Scottsdale (United States) - 72.167.232.86
    G Analytics ID: UA-6896895-4
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 4
  3. Find Bed Bath And Beyond Coupon Online With Us
    Learn here how to use internet in order to get Bed Bath And Beyond Coupon Online
    Houston (United States) - 192.185.35.54
    Server software: nginx/1.10.0
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, LiveInternet counter, Wordpress, Facebook Like box
    Number of Javascript: 8
    Number of meta tags: 4
  4. Hilton Waikiki Beach Hotel - Waikiki Beach HotelWaikiki Beach | Hilton Hotel
    Hilton Waikiki Beach Hotel. is one block from the legendary water of Waikiki Beach and is an Ideally located one block from Waikiki Beach.
    Torrance (United States) - 204.10.140.95
    Server software: Apache/2.2.16
    Technology: CSS, Html, Html5, Javascript, jQuery Hover Intent, Php, Pingback, SVG, Swf Object, Facebook Retargeting, Google Analytics, Quantcast Measurement, Wordpress, Facebook Box
    Number of Javascript: 17
    Number of meta tags: 4
  5. Main Server
    Ann Arbor (United States) - 199.195.119.28
    Server software: nginx/1.0.15
    Technology: Html, Html5
    Number of Javascript: 3
    Number of meta tags: 1
  6. Amys Kinderpage
    Germany - 87.238.192.109
    Server software: Apache/2.2.17 (Unix) DAV/2 PHP/4.4.9 mod_fcgid/2.3.5
    Technology: Html
    Number of meta tags: 5
  7. DESIGN
    United Kingdom - 79.170.40.239
    Server software: Apache/2.4.23 (Unix)
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  8. 주식회사 코리아마님
    3D메쉬 매트 패드 방석
    Korea, Republic of - 211.233.51.142
    Server software: nginx
    Technology: CSS, Html, Iframe, Javascript, Php
    Number of Javascript: 11
    Number of meta tags: 4
  9. Medallion House - Build Your Dream Home
    Los Angeles (United States) - 198.252.106.73
    Server software: LiteSpeed
    Technology: CSS, Html, Html5, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 3
    Number of meta tags: 3
  10. legacycreekfarmscreenprinting.biz
    Road Town (Virgin Islands, British) - 208.91.197.39
    Server software: Apache
    Technology: Html
    Number of meta tags: 2